PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_7AL_0AD4A7A87.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 226aa    MW: 25500.7 Da    PI: 11.3948
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_7AL_0AD4A7A87.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.68.9e-162572148
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
        Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                           +g+WT+ Ed  l+d v+++G g+W+++ r+ g+ R++k+c++rw ++l
  Traes_7AL_0AD4A7A87.1 25 KGPWTQAEDRVLLDHVRRHGEGNWNAVRRETGLQRCGKSCRLRWANHL 72
                           79******************************************9996 PP

2Myb_DNA-binding48.22.4e-1578121146
                            TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
        Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                            +g++++eE+ l+++++ + G++ W++I+ +++ gRt++++k++w++
  Traes_7AL_0AD4A7A87.1  78 KGPFSPEEERLILRLHGLIGNK-WARISTHLP-GRTDNEVKNFWNT 121
                            79********************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.0252072IPR017930Myb domain
SuperFamilySSF466892.3E-3022119IPR009057Homeodomain-like
SMARTSM007171.4E-122474IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.2E-222679IPR009057Homeodomain-like
CDDcd001671.22E-112772No hitNo description
PfamPF139217.6E-152887No hitNo description
PROSITE patternPS0017504049IPR001345Phosphoglycerate/bisphosphoglycerate mutase, active site
PROSITE profilePS5129425.673127IPR017930Myb domain
SMARTSM007172.8E-1577125IPR001005SANT/Myb domain
CDDcd001671.22E-1180123No hitNo description
Gene3DG3DSA:1.10.10.601.4E-2480126IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008152Biological Processmetabolic process
GO:0003677Molecular FunctionDNA binding
GO:0003824Molecular Functioncatalytic activity
Sequence ? help Back to Top
Protein Sequence    Length: 226 aa     Download sequence    Send to blast
MATAMDTTVP RSGVGEGGGG GGLKKGPWTQ AEDRVLLDHV RRHGEGNWNA VRRETGLQRC  60
GKSCRLRWAN HLRPNLRKGP FSPEEERLIL RLHGLIGNKW ARISTHLPGR TDNEVKNFWN  120
TRLKRRQRAG QSLYPPDVER EIALMRAQNI NPFADADGNT AASPFSDPFA LPPRPPSSTK  180
PPSHSHSSPL IDQHHPLLNQ MQGMQMRHHA AQHQHPQPAF HHHHHH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-28231265107B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3738040.0AK373804.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv3044A21.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004966213.11e-110PREDICTED: uncharacterized protein LOC101767992 isoform X1
RefseqXP_004966214.11e-111PREDICTED: transcription factor GAMYB isoform X2
SwissprotA2WW876e-63GAM1_ORYSI; Transcription factor GAMYB
SwissprotQ0JIC25e-63GAM1_ORYSJ; Transcription factor GAMYB
TrEMBLW5H6481e-167W5H648_WHEAT; Uncharacterized protein
STRINGSi006555m1e-109(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP123972632
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06100.19e-59myb domain protein 33
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]